Cat: PA1000-1272

Recombinant Human GLYATL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLYATL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLYATL2GAT;Glycine N-acyltransferase-like Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WU03

  • Expression Region

    1-294aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMLVLHNSQKLQILYKSLEKSIPESIKV YGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHI FTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDY MKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVN EHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGY TVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFK ICPCGWHQWKCTPKKYC

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLYATL2, a member of the glycine N-methyltransferase family, has garnered significant interest in biomedical research due to its potential role in regulating glycine metabolism and associated pathways. Glycine, an amino acid, is crucial for various physiological processes, including protein synthesis and neurotransmission. Dysregulation of glycine levels has been linked to several health conditions, including neurological disorders and metabolic syndromes. Studying the recombinant GLYATL2 protein enables researchers to elucidate its enzymatic properties, substrate specificity, and interaction with other metabolites. Additionally, understanding GLYATL2’s function can provide insights into its involvement in critical cellular processes and its potential as a therapeutic target for diseases linked to glycine dysregulation. This research also contributes to the broader understanding of methylation processes in human health and disease, highlighting the importance of GLYATL2 in metabolic pathways and its potential implications for drug development and clinical applications. Overall, the exploration of GLYATL2's recombinant protein adds a significant dimension to our understanding of metabolic enzymes and their roles in maintaining homeostasis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US