Analytical Data
-
Gene name
GRA6
- Application
-
Alternative Names
GRA6；TG24；Dense granule Protein 6
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q27003
-
Expression Region
35-150aa
-
AA Sequence
NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR
-
Molecular Weight
38.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRA6 (Glycosylphosphatidylinositol-anchored protein 6) is a crucial protein involved in the pathogenesis and immune evasion strategies of Toxoplasma gondii, an obligate intracellular parasite responsible for toxoplasmosis in humans and animals. The study of GRA6 is particularly significant due to its role in modulating host immune responses and promoting parasite survival within the host cells. Research has shown that GRA6 interacts with various host proteins, altering cellular signaling pathways and facilitating the creation of a protective niche for the parasite. Further investigations into the structural and functional properties of GRA6 have underscored its potential as a target for vaccine development and therapeutic interventions. Understanding the mechanisms by which GRA6 influences host-parasite interactions could provide valuable insights into the design of strategies aimed at controlling Toxoplasma gondii infections. Additionally, the characterization of GRA6 and its recombinant forms offers prospects for improving diagnostic methods and developing novel approaches to mitigate the impact of this widespread zoonotic disease.
