Analytical Data
-
Gene name
HIST1H4I
- Application
-
Alternative Names
dJ160A22.1; dJ160A22.2; dJ221C16.1; dJ221C16.9; FO108; H4; H4.k; H4/a; H4/b; H4/c; H4/d; H4/e; H4/g; H4/h; H4/I; H4/j; H4/k; H4/m; H4/n; H4/p; H4_HUMAN; H4F2; H4F2iii; H4F2iv; H4FA; H4FB; H4FC; H4FD; H4FE; H4FG; H4FH; H4FI; H4FJ; H4FK; H4FM; H4FN; H4M; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4; HIST2H4A; Hist4h4; Histone 1 H4a
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62805
-
Expression Region
1-103aa
-
AA Sequence
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGPIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
-
Molecular Weight
37.07 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H4I, a gene encoding the histone H4 protein, plays a critical role in the organization and packaging of DNA within the cell nucleus, forming nucleosomes that help regulate genetic expression and protect DNA integrity. The research surrounding HIST1H4I has gained significance due to its involvement in epigenetic regulation and its potential implications in various diseases, including cancer. Histone proteins, including HIST1H4I, undergo various post-translational modifications that influence chromatin structure and function, affecting gene transcription and cellular processes. Abnormalities in histone variant expression, such as HIST1H4I, have been associated with tumorigenesis and cancer progression, making it a focus of intense study in cancer biology. Understanding the biochemical properties and interactions of the HIST1H4I protein, as well as its role in chromatin dynamics, can provide insights into the mechanisms of gene regulation and the development of novel therapeutic strategies aimed at targeting epigenetic modifications in diseases. Recombinant HIST1H4I proteins are being utilized in laboratory studies to explore their structural characteristics, interactions with other chromatin-associated proteins, and their functional consequences on gene expression, thereby contributing to a deeper understanding of the intricate processes governing cellular function and disease pathology.
