Cat: PA1000-1271

Recombinant Human GLYAT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLYAT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLYAT;ACGNAT;CAT;Glycine N-acyltransferase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6IB77

  • Expression Region

    1-296aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMMLPLQGAQMLQMLEKSLRKSLPASLKVYG TVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYS KDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQ RILYMAAETAKELTPFLLKSKILSPSGGKPKAINQEMFKLSSMDVTHAHL VNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRM AGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQ HVPIPRSWNQWNCVPL

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLYAT, or glycine N-acyltransferase, is an important enzyme involved in the metabolism of glycine and the detoxification of various acyl-CoA derivatives. Research into GLYAT has gained prominence due to its role in metabolic pathways, particularly in the context of amino acid conjugation and the regulation of biochemical processes. Abnormalities in GLYAT function have been linked to various metabolic disorders, highlighting its potential as a therapeutic target. The recombinant production of GLYAT protein has enabled detailed studies into its enzymatic properties, substrate specificity, and regulatory mechanisms. Furthermore, understanding the structure-function relationship of GLYAT can provide insights into its role in health and disease. The development of recombinant GLYAT not only facilitates the exploration of its biochemical properties but also opens avenues for drug development and the design of therapeutic strategies for conditions linked to glycine metabolism dysregulation. As such, ongoing research into GLYAT, including its recombinant protein forms, is critical for advancing our knowledge of metabolic regulation and its implications in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US