Cat: PA1000-1250

Recombinant Human glk Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    glk

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    glk;GRIK;Glutamate receptor ionotropic. kainate 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IVH8

  • Expression Region

    1-380aa

  • AA Sequence

    MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLE PGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQD IYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHV KLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAV GITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFV KMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDF DDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHH ELPDSDGFLD SSEEIYYTARSNLDLQLEYG

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLK (Glycogen Synthase Kinase-3-like) proteins are a family of serine/threonine kinases that play crucial roles in various cellular processes, including cell signaling, metabolism, and development. Their significance has been underscored by their involvement in critical pathways such as glycogen metabolism and signal transduction. Research has indicated that GLK proteins are conserved across multiple species, suggesting their fundamental role in biological systems. In the context of cancer, neurodegenerative diseases, and metabolic disorders, abnormal regulation of GLK activity has been associated with disease progression, highlighting the need for a deeper understanding of their function and regulation. The study of GLK recombinant proteins provides a valuable tool for elucidating the biochemical properties and mechanisms of action of these kinases. By producing these proteins in a controlled environment, researchers can investigate their interaction with substrates and inhibitors, as well as their role in cellular signaling cascades. Understanding GLK's structure-function relationship through recombinant techniques can pave the way for the development of targeted therapeutic strategies aimed at modulating GLK activity in disease contexts. Overall, the exploration of GLK recombinant proteins is vital for uncovering their biological roles and therapeutic potential, addressing significant gaps in our current understanding of cellular regulation and disease pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US