Cat: PA2000-4094

Recombinant Human FTO Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FTO

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FTO;KIAA1752;Alpha-ketoglutarate-dependent dioxygenase FTO

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9C0B1

  • Expression Region

    32-505aa

  • AA Sequence

    TPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRD LVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAE IAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVGM GSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWH HDENLVDRSAVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIE TPGLAIPLHQGDCYFMLDDLNATHQHCVLAGSQPRFSSTHRVAECSTGTL DYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQ FWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQR NEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDA SMPLPFDLTDIVSELRGQLLEAKP

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FTO (Fat mass and obesity-associated protein) is a well-studied gene that encodes a member of the α-ketoglutarate-dependent dioxygenase family, playing a significant role in the regulation of energy balance, body weight, and metabolism. Initially identified as a susceptibility gene for obesity, FTO has garnered attention due to its nuanced involvement in various biological processes, including RNA metabolism and epigenetic regulation. Recent research suggests that FTO preferentially demethylates N6-methyladenosine (m6A) modifications on RNA, influencing mRNA stability and translation. The protein's function in energy metabolism and its interactions within metabolic pathways have made FTO a target of interest for potential therapeutic interventions in obesity and related metabolic disorders. Additionally, FTO's diverse roles span cellular processes such as adipogenesis and neurogenesis, indicating its significance beyond mere obesity regulation. As research progresses, the recombinant expression of FTO protein allows for detailed structural and functional studies, essential for elucidating its mechanisms of action and interactions. Investigating FTO through recombinant technologies holds promise for the development of novel strategies in managing obesity, enhancing our understanding of metabolic syndrome, and addressing the global health challenges associated with these conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US