Analytical Data
-
Gene name
PLCg1
- Application
-
Alternative Names
PLCg1；PLC1；1-phosphatidylinositol 4.5-bisphosphate phosphodiesterase gamma-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19174
-
Expression Region
1192-1291aa
-
AA Sequence
LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLF HGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLCg1, or phospholipase C gamma 1, is a critical enzyme involved in various cellular signaling pathways that regulate vital biological processes such as cell growth, differentiation, and apoptosis. It is primarily activated by receptor tyrosine kinases and G-protein-coupled receptors, leading to the hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) and the subsequent generation of inositol trisphosphate (IP3) and diacylglycerol (DAG). These second messengers play crucial roles in calcium signaling and protein kinase activation, ultimately affecting various cellular functions. Dysregulation of PLCg1 activity has been linked to numerous diseases, including cancer, neurological disorders, and cardiovascular diseases, making it a significant target for therapeutic interventions. Recent research has focused on the structural and functional characterization of PLCg1, with the goal of understanding its precise mechanisms of action and exploring its potential as a biomarker or therapeutic target. The recombinant expression of PLCg1 and the study of its biochemical properties contribute to the development of novel drugs and treatment strategies, highlighting its importance in both basic research and clinical applications.
