Cat: PA1000-1249

Recombinant Human GLIPR2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLIPR2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLIPR2;C9orf19;GAPR1;Golgi-associated plant pathogenesis-related Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H4G4

  • Expression Region

    1-154aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGKSASKQFHNEVLKAHNEYRQKHGVPPLK LCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKEVA DRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVV ARYFPAGNVVNEGFFEENVLPPKK

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLIPR2 (Glioma pathogenesis-related protein 2) is a member of the glioma pathogenesis-related protein family, which has garnered interest due to its potential role in cancer biology, particularly in gliomas and other tumors. Research indicates that GLIPR2 may function as a tumor suppressor, influencing cell proliferation, survival, and apoptosis. Its expression levels are often altered in various cancers, suggesting a correlation with tumor progression and patient prognosis. The study of recombinant GLIPR2 proteins is crucial for understanding its structure-function relationship and elucidating the molecular pathways it may regulate. By engineering and expressing recombinant GLIPR2, researchers can investigate its biological activities, potential interactions with other cellular proteins, and its overall impact on cancer cell behavior. This research not only aims to clarify the exact role of GLIPR2 in tumorigenesis but also explores its potential as a therapeutic target or biomarker in cancer diagnostics and treatment strategies. As the scientific community continues to unravel the complexities of cancer biology, understanding the functional implications of proteins like GLIPR2 will be essential in developing more effective interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US