Cat: PA2000-8246

Recombinant Human HINT3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HINT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HINT-3; HINT3; HINT3_HUMAN; Histidine triad nucleotide-binding protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NQE9

  • Expression Region

    1-182aa

  • AA Sequence

    MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT

  • Molecular Weight

    46.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HINT3 (Histidine Triad Nucleotide-binding Protein 3) is a member of the histidine triad protein family, which plays significant roles in various cellular processes, including nucleotide binding and intracellular signaling. Research into HINT3 has gained traction due to its involvement in key biological functions and its potential implications in cancer biology, particularly in the context of tumor suppression and apoptosis. Previous studies have indicated that HINT3 may act as a regulator of cell proliferation and survival, suggesting that its dysregulation could contribute to tumorigenesis. Furthermore, HINT3 has been implicated in several signaling pathways, making it a candidate for therapeutic targeting in cancer treatment. The exploration of HINT3 as a recombinant protein aims to elucidate its structure-function relationships, enhance our understanding of its biochemical properties, and develop potential applications in diagnostic and therapeutic strategies. The production and characterization of HINT3 as a recombinant protein provide a foundation for further research into its role in health and disease, potentially leading to innovative approaches in disease management, particularly in oncological settings. The ongoing investigation not only seeks to clarify the physiological functions of HINT3 but also aims to uncover its potential as a novel biomarker or therapeutic target, highlighting its relevance in modern biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US