Analytical Data
-
Gene name
HINT3
- Application
-
Alternative Names
HINT-3; HINT3; HINT3_HUMAN; Histidine triad nucleotide-binding protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQE9
-
Expression Region
1-182aa
-
AA Sequence
MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HINT3 (Histidine Triad Nucleotide-binding Protein 3) is a member of the histidine triad protein family, which plays significant roles in various cellular processes, including nucleotide binding and intracellular signaling. Research into HINT3 has gained traction due to its involvement in key biological functions and its potential implications in cancer biology, particularly in the context of tumor suppression and apoptosis. Previous studies have indicated that HINT3 may act as a regulator of cell proliferation and survival, suggesting that its dysregulation could contribute to tumorigenesis. Furthermore, HINT3 has been implicated in several signaling pathways, making it a candidate for therapeutic targeting in cancer treatment. The exploration of HINT3 as a recombinant protein aims to elucidate its structure-function relationships, enhance our understanding of its biochemical properties, and develop potential applications in diagnostic and therapeutic strategies. The production and characterization of HINT3 as a recombinant protein provide a foundation for further research into its role in health and disease, potentially leading to innovative approaches in disease management, particularly in oncological settings. The ongoing investigation not only seeks to clarify the physiological functions of HINT3 but also aims to uncover its potential as a novel biomarker or therapeutic target, highlighting its relevance in modern biomedical research.
