Cat: PA2000-42DB

Recombinant Human UCN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UCN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UCN;Urocortin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55089

  • Expression Region

    1-124aa

  • AA Sequence

    MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK

  • Molecular Weight

    13.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of UCN (Urocortin) recombinant proteins has garnered significant attention due to their potential therapeutic applications in various physiological and pathological conditions. UCN is a member of the corticotropin-releasing factor (CRF) family and plays a critical role in the regulation of stress responses, appetite, and neuroendocrine functions. Research has indicated that UCN can modulate cardiovascular functions, promote neuroprotection, and influence metabolism, making it a promising candidate for treating stress-related disorders, anxiety, and obesity. The ability to produce UCN as a recombinant protein allows for the detailed study of its structure-function relationships and biological mechanisms, paving the way for the development of novel therapeutic strategies. As recombinant DNA technology continues to advance, the production of UCN in various expression systems, such as bacteria and yeast, has enabled researchers to obtain large quantities of high-purity protein for experimental analysis. Furthermore, understanding the interactions between UCN and its receptors could illuminate new pathways for drug development. Overall, the investigation of UCN recombinant proteins is a rapidly evolving field that intersects molecular biology, pharmacology, and clinical research, with the potential to yield innovative solutions for managing stress-related conditions and enhancing emotional well-being.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US