Analytical Data
-
Gene name
HHLA3
- Application
-
Alternative Names
HHLA3HERV-H LTR-associating protein 3; Human endogenous retrovirus-H long terminal repeat-associating protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9XRX5
-
Expression Region
1-121aa
-
AA Sequence
MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVCLVNGKGSLSRPQESILGSLARKNLRRIHRVSLVMCVRPLSPSKAIISPVTCMYTSRWPEASEESQKK
-
Molecular Weight
39.71 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HHLA3 (Human HLA-Associated Ligand A3) is a member of the B7 family of costimulatory molecules and plays a crucial role in regulating immune responses. Its expression is primarily observed in immune cells and certain tumors, suggesting a potential involvement in immune evasion during cancer progression. Research has indicated that HHLA3 interacts with the programmed cell death protein 1 (PD-1) receptor, providing insights into its role in T-cell inhibition and immune checkpoint regulation. The understanding of HHLA3's mechanism of action could offer significant implications for the development of novel immunotherapeutic strategies aimed at enhancing anti-tumor immunity. Recombinant HHLA3 protein has become a valuable tool in investigating its interactions and functions, enabling researchers to elucidate its contributions to both cancer biology and immune modulation. Overall, the study of HHLA3 not only furthers the understanding of immune checkpoint pathways but also potentially leads to new avenues for therapeutic intervention in cancer and other diseases characterized by immune dysregulation.
