Analytical Data
-
Gene name
GET4
- Application
-
Alternative Names
GET4；C7orf20；CEE;Golgi to ER traffic Protein 4 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L5D6
-
Expression Region
1-327aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAAAAAMAEQESARNGGRNRGGVQRVE GKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHTEARELMYSGALLFFSHG QQNSAADLSMLVLESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVS RALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSADGEGCAN MLVEYSTSRGFRSEVDMFVAQAVLQFLCLKNKSSASVVFTTYTQKHPSIE DGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLD RIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GET4, or Generalized Export and Transport 4, is a protein that plays a critical role in the cellular protein quality control system, specifically in the endoplasmic reticulum (ER) associated degradation (ERAD) pathway. Research into GET4 has been driven by its importance in maintaining cellular homeostasis by facilitating the recognition, extraction, and degradation of misfolded or non-functional proteins within the ER. Misfolded proteins can lead to severe cellular stress and are associated with various diseases, including neurodegenerative disorders and certain cancers. Scientists have focused on understanding the molecular mechanisms through which GET4 interacts with other components of the ERAD machinery, enhancing our comprehension of protein folding and degradation processes. Through biochemical assays, structural biology, and genetic studies, researchers aim to elucidate the functional dynamics of GET4. By investigating its role in the context of ER stress responses, the potential implications of GET4 in therapeutic strategies for diseases related to protein misfolding are also being explored. Consequently, understanding GET4's function not only sheds light on fundamental cellular processes but also opens avenues for the development of novel interventions in diseases linked to protein misfolding and aggregation.
