Analytical Data
-
Gene name
HES4
- Application
-
Alternative Names
HES4; BHLHB42; Transcription factor HES-4; hHES4; Class B basic helix-loop-helix protein 42; bHLHb42; Hairy and enhancer of split 4; bHLH factor Hes4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HCC6
-
Expression Region
1-221aa
-
AA Sequence
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR
-
Molecular Weight
49.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HES4, or Hairy and Enhancer of Split 4, is a member of the basic helix-loop-helix (bHLH) transcription factor family, which plays a crucial role in the regulation of developmental processes and cell fate determination. It is known to be involved in the Notch signaling pathway, a fundamental mechanism that influences cell differentiation, proliferation, and apoptosis. Research has shown that HES4 is particularly significant in the development of the central nervous system and in the maintenance of neural stem cells. Aberrations in HES4 expression have been linked to various neurodevelopmental disorders and cancers, highlighting its potential as a therapeutic target. The study of HES4 recombinant protein is essential for understanding its functional mechanisms, including how it interacts with other proteins and transcription factors in the nucleus. By utilizing recombinant DNA technology to produce HES4 protein, researchers can analyze its structural properties, binding affinities, and regulatory effects on target genes. This research not only enhances our understanding of HES4's role in normal physiological conditions but also provides insights into its involvement in pathological states. Overall, the investigation of HES4 recombinant protein offers a promising avenue for advancing knowledge in developmental biology, neurobiology, and potential therapeutic interventions.
