Cat: PA2000-8227

Recombinant Human HES4 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HES4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HES4; BHLHB42; Transcription factor HES-4; hHES4; Class B basic helix-loop-helix protein 42; bHLHb42; Hairy and enhancer of split 4; bHLH factor Hes4

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HCC6

  • Expression Region

    1-221aa

  • AA Sequence

    MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR

  • Molecular Weight

    49.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HES4, or Hairy and Enhancer of Split 4, is a member of the basic helix-loop-helix (bHLH) transcription factor family, which plays a crucial role in the regulation of developmental processes and cell fate determination. It is known to be involved in the Notch signaling pathway, a fundamental mechanism that influences cell differentiation, proliferation, and apoptosis. Research has shown that HES4 is particularly significant in the development of the central nervous system and in the maintenance of neural stem cells. Aberrations in HES4 expression have been linked to various neurodevelopmental disorders and cancers, highlighting its potential as a therapeutic target. The study of HES4 recombinant protein is essential for understanding its functional mechanisms, including how it interacts with other proteins and transcription factors in the nucleus. By utilizing recombinant DNA technology to produce HES4 protein, researchers can analyze its structural properties, binding affinities, and regulatory effects on target genes. This research not only enhances our understanding of HES4's role in normal physiological conditions but also provides insights into its involvement in pathological states. Overall, the investigation of HES4 recombinant protein offers a promising avenue for advancing knowledge in developmental biology, neurobiology, and potential therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US