Analytical Data
-
Gene name
HES3
- Application
-
Alternative Names
HES3; BHLHB43Transcription factor HES-3; Class B basic helix-loop-helix protein 43; bHLHb43; Hairy and enhancer of split 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TGS1
-
Expression Region
1-186aa
-
AA Sequence
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN
-
Molecular Weight
20.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HES3, a member of the Hairy and Enhancer of Split (HES) family of proteins, plays a crucial role in the regulation of neural development and cell differentiation. This protein functions as a transcriptional repressor, influencing the Notch signaling pathway, which is essential for maintaining the balance between neural stem cell proliferation and differentiation. With the growing interest in regenerative medicine and neurodevelopmental disorders, studying HES3 recombinant proteins has gained significance, as it provides insights into the mechanisms underlying neural patterning and the potential for developing therapeutic strategies. Researchers investigate the expression, purification, and functional characterization of HES3 recombinant proteins to elucidate their role in cellular processes and to explore their application in treating conditions such as neurodegenerative diseases and gliomas. Moreover, understanding the interactions and regulatory mechanisms of HES3 can enhance our knowledge of stem cell biology and its application in tissue engineering. As research progresses, the development of HES3-based applications could pave the way for novel interventions in neuroscience and regenerative therapies.
