Cat: PA2000-4064

Recombinant Human CSH2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CSH2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CSH2;Chorionic somatomammotropin hormone 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0DML3

  • Expression Region

    27-217aa

  • AA Sequence

    VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

  • Molecular Weight

    53.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CSH2, also known as Cystathionine γ-lyase 2, is a member of the cystathionine β-synthase family of enzymes, which play a crucial role in the transsulfuration pathway. This pathway is significant for the metabolism of sulfur-containing amino acids, impacting the production of hydrogen sulfide (H2S), a signaling molecule with various physiological roles. Abnormalities in the function of CSH2 are linked to several pathological conditions, including cardiovascular diseases, neurodegenerative disorders, and metabolic syndrome. Research into the recombinant protein expression of CSH2 is essential for understanding its enzymatic properties, structure-function relationships, and regulatory mechanisms. By producing CSH2 as a recombinant protein in suitable host organisms, researchers can characterize its kinetic parameters, evaluate its potential as a therapeutic target, and explore its role in cellular signaling. Furthermore, studying CSH2 at the molecular level may reveal insights into its involvement in the pathophysiology of diseases, paving the way for novel therapeutic strategies. The growing interest in H2S as a biological mediator has further elevated CSH2's significance in biomedical research, highlighting the need for detailed investigations into its biochemical properties and physiological implications. Hence, the recombinant expression and characterization of CSH2 not only enhance our understanding of its biological functions but also contribute to the development of targeted interventions for related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US