Analytical Data
-
Gene name
TNFb
- Application
-
Alternative Names
TNFb；TNFB；TNFSF1；Lymphotoxin-alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01374
-
Expression Region
35-205aa
-
AA Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTD RAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHE VQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTH TDGIPHLVLSPSTVFFGAFAL
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tumor Necrosis Factor beta (TNFb), also known as Lymphotoxin-alpha, is a cytokine that plays a crucial role in immune regulation and inflammation. It is primarily produced by activated T and Natural Killer (NK) cells and is known for its ability to induce cell apoptosis, promote cell proliferation, and modulate immune responses. The functional diversity of TNFb has garnered significant attention in the fields of immunology and cancer research, as it is involved in various pathological and physiological processes. The exploration of recombinant TNFb proteins is essential for understanding its molecular mechanisms and biological activities. By producing TNFb in recombinant systems, researchers can gain insights into its structure-function relationship, effects on various cell types, and potential therapeutic applications. Furthermore, studying TNFb in a recombinant form enables the development of targeted therapies for autoimmune diseases and cancer, paving the way for treatments that can manipulate TNFb signaling pathways. The advancements in recombinant DNA technology have made it possible to produce large quantities of TNFb, facilitating detailed studies into its role in tumorigenesis and chronic inflammation. This research not only enhances our understanding of TNFb's biological functions but also helps in the identification of biomarkers for disease and potential drug targets, contributing to the development of innovative therapeutic approaches.
