Analytical Data
-
Gene name
HEMK2
- Application
-
Alternative Names
N6AMT1; C21orf127; HEMK2; PRED28; Methyltransferase N6AMT1; HemK methyltransferase family member 2; M.HsaHemK2P; Methylarsonite methyltransferase N6AMT1; EC 2.1.1.-; N(6)-adenine-specific DNA methyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5N5
-
Expression Region
1-186aa
-
AA Sequence
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HEMK2 (Heme Oxygenase-1 and Extracellular Signal-Regulated Kinase) is a key enzyme involved in the catabolism of heme, playing a crucial role in cellular response to stress and inflammation. The study of HEMK2 recombinant protein has gained significant attention due to its potential implications in various pathological conditions, including neurodegenerative diseases, cancer, and cardiovascular disorders. Research indicates that HEMK2 may modulate oxidative stress and contribute to cytoprotection, making it a target of interest for therapeutic interventions. Moreover, the recombinant expression of HEMK2 allows for detailed investigations into its structural and functional properties, facilitating the exploration of its enzymatic activity and regulatory mechanisms. Understanding the role of this protein at the molecular level may lead to the development of novel strategies for disease management and enhance our comprehension of heme metabolism. As the demand for high-quality recombinant proteins in research and therapeutic applications continues to grow, the production and characterization of HEMK2 can provide valuable insight into its biological significance and potential uses in medicine.
