Analytical Data
-
Gene name
MOSC1
- Application
-
Alternative Names
MOSC1；MARC1；MOSC1；Mitochondrial amidoxime-reducing component 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VT66
-
Expression Region
1-337aa
-
AA Sequence
MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ
-
Molecular Weight
37.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOSC1 (Mosaic 1) is a novel protein that has garnered significant attention in the field of molecular biology due to its role in various cellular processes, including protein folding, stress response, and mitochondrial function. Researchers have identified MOSC1 as a critical component in the mitochondrial protein import system, which is vital for cellular energy production and maintaining cellular homeostasis. Dysregulation of MOSC1 has been linked to several diseases, including neurodegenerative disorders and cancer, highlighting its potential as a therapeutic target. Studies have shown that MOSC1 interacts with chaperone proteins and import machinery, facilitating the precise translocation of precursor proteins into mitochondria. This underscores its importance in cellular metabolism and response to stress. Understanding the structure and function of MOSC1 through recombinant protein studies can shed light on its mechanism of action and provide insights into its functional role in human health. As researchers continue to unravel the complexities of MOSC1, the development of recombinant versions of this protein will not only advance our knowledge of mitochondrial biology but may also pave the way for innovative strategies in treating diseases associated with mitochondrial dysfunction.
