Cat: PA2000-4044

Recombinant Human SCN1A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCN1A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SCN1A;NAC1;SCN1;Sodium channel Protein type 1 subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35498

  • Expression Region

    1-128aa

  • AA Sequence

    MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

  • Molecular Weight

    18.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCN1A, a gene encoding the alpha subunit of voltage-gated sodium channels, plays a crucial role in neuronal excitability. Mutations in SCN1A are associated with various neurological disorders, particularly Dravet syndrome, a severe form of epilepsy that typically manifests in infancy. The SCN1A protein is essential for the proper functioning of sodium channels in neurons, influencing action potential generation and propagation. Given the implications of SCN1A mutations in epilepsy and other neurological conditions, researchers are focusing on understanding the structure and function of the SCN1A protein through recombinant protein expression techniques. Studying the recombinant SCN1A protein allows scientists to investigate the effects of specific mutations, explore the biophysical properties of the sodium channel, and assess potential therapeutic interventions. This research is vital for developing targeted treatments for patients with SCN1A-related disorders, as it could lead to personalized medical approaches that improve patient outcomes and advance our understanding of channelopathies. The ongoing exploration of SCN1A not only provides insight into the molecular mechanisms underlying epilepsy but also offers a platform for discovering new pharmacological agents that may modulate sodium channel activity and provide relief for affected individuals.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US