Analytical Data
-
Gene name
SCN1A
- Application
-
Alternative Names
SCN1A；NAC1；SCN1；Sodium channel Protein type 1 subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35498
-
Expression Region
1-128aa
-
AA Sequence
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS
-
Molecular Weight
18.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCN1A, a gene encoding the alpha subunit of voltage-gated sodium channels, plays a crucial role in neuronal excitability. Mutations in SCN1A are associated with various neurological disorders, particularly Dravet syndrome, a severe form of epilepsy that typically manifests in infancy. The SCN1A protein is essential for the proper functioning of sodium channels in neurons, influencing action potential generation and propagation. Given the implications of SCN1A mutations in epilepsy and other neurological conditions, researchers are focusing on understanding the structure and function of the SCN1A protein through recombinant protein expression techniques. Studying the recombinant SCN1A protein allows scientists to investigate the effects of specific mutations, explore the biophysical properties of the sodium channel, and assess potential therapeutic interventions. This research is vital for developing targeted treatments for patients with SCN1A-related disorders, as it could lead to personalized medical approaches that improve patient outcomes and advance our understanding of channelopathies. The ongoing exploration of SCN1A not only provides insight into the molecular mechanisms underlying epilepsy but also offers a platform for discovering new pharmacological agents that may modulate sodium channel activity and provide relief for affected individuals.
