Cat: PA1000-1204

Recombinant Human GBA3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GBA3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GBA3;CBG;CBGL1;Cytosolic beta-glucosidase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H227

  • Expression Region

    1-469aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAFPAGFGWAAATAAYQVEGGWDADGK GPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFS LSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQTL EDQGGWLSEAIIESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLG MFPPGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRKKQKGMVSLSLFAV WLEPADPNSVSDQEAAKRAITFHLDLFAKPIFIDGDYPEVVKSQIASMSQ KQGYPSSRLPEFTEEEKKMIKGTADFFAVQYYTTRLIKYQENKKGELGIL QDAEIEFFPDPSWKNVDWIYVVPWGVCKLLKYIKDTYNNPVIYITENGFP QSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLLDNFEWNQ GYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GBA3, or glucocerebrosidase 3, is an enzyme that plays a significant role in the lysosomal degradation of glucocerebrosides, crucial for cellular lipid metabolism. Abnormal function or mutations in GBA genes, particularly GBA1, are primarily associated with Gaucher's disease, whereas GBA3's role has been less understood yet holds potential importance in various pathophysiological conditions. Recent studies have suggested that GBA3 may have a regulatory role in immune response and neurodegeneration, indicating its potential impact on diseases like Parkinson’s. The study of recombinant GBA3 proteins is vital for elucidating its biochemical functions and interactions, as well as for exploring its therapeutic potentials. Understanding the structural and functional characteristics of GBA3 could offer insights into enzyme replacement therapies and other interventions for related disorders. This research is particularly relevant given the rising interest in gene therapy and enzyme modulation therapies, which hold promise for treating lysosomal storage diseases and neurodegenerative disorders. Overall, the investigation of GBA3 recombinant proteins is critical for uncovering their biological roles and advancing therapeutic strategies in the context of cellular dysfunctions linked to lipid metabolism and neuroinflammation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US