Analytical Data
-
Gene name
TRA2b
- Application
-
Alternative Names
TRA2b；SFRS10；Transformer-2 Protein homolog beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62995
-
Expression Region
120-199aa
-
AA Sequence
LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENV DDAKEAKERANGMELDGRRIRVDFSITKRP
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRA2b (Transformer-2 beta) is a splicing factor that plays a crucial role in the regulation of gene expression and splicing processes. It is part of the SR (serine/arginine-rich) protein family, known for its involvement in alternative splicing, which is a key mechanism that generates protein diversity in eukaryotic cells. Recent studies have emphasized TRA2b's significance in various biological processes, including embryonic development, cell differentiation, and response to cellular stress. Dysregulation of TRA2b has been linked to several diseases, including cancer, where it may influence the splicing patterns of oncogenes and tumor suppressors. As researchers continue to explore its functional implications, recombinant TRA2b protein has emerged as a valuable tool for studying splicing mechanisms and interactions with other proteins. By producing TRA2b as a recombinant protein, scientists can investigate its structure-function relationships, identify potential post-translational modifications, and understand its role in splicing complexes. This research is vital in elucidating the molecular underpinnings of splicing-related disorders and could lead to the development of targeted therapeutic strategies for diseases associated with aberrant splicing. Thus, the study of TRA2b recombinant protein not only enhances our understanding of fundamental biological processes but also holds promise for advancing biomedical research and therapeutic innovations.
