Cat: PA1000-1190

Recombinant Human GALM Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GALM

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GALM;Galactose mutarotase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96C23

  • Expression Region

    1-342aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMASVTRAVFGELPSGGGTVEKFQLQSDLLR VDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVA NRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFS RISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN LAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVEL GKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEE YDHTTWFKFSVA

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GALM (Galactose-1-phosphate uridylyltransferase and galactose-4-epimerase) is an essential enzyme complex involved in the metabolism of galactose, specifically in the conversion of galactose-1-phosphate to UDP-galactose. Congenital disorders of galactose metabolism, particularly galactosemia, arise from deficiencies in these enzymes, leading to severe clinical manifestations such as liver damage, kidney complications, and neurological impairment if left untreated. Research on GALM recombinant proteins has gained traction as scientists seek to understand the structure-function relationships and regulatory mechanisms involved in its enzymatic activity. These studies provide insights into critical aspects of galactose metabolism and potential therapeutic strategies for managing metabolic disorders related to galactose. Advances in techniques such as protein engineering and structural biology enable researchers to produce and characterize GALM variants, facilitating a deeper understanding of its role in metabolic pathways and offering new avenues for enzyme replacement therapies. By elucidating the molecular intricacies of GALM, researchers aim to pave the way for innovative treatments and interventions to improve the quality of life for individuals affected by galactose-related metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US