Analytical Data
-
Gene name
HBLD1
- Application
-
Alternative Names
ISCA2. HBLD1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86U28
-
Expression Region
1-154aa
-
AA Sequence
MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL
-
Molecular Weight
42.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HBLD1 (Hypoxia-Associated Protein Locus D1) is a relatively new member of the family of proteins that are associated with hypoxic conditions and various cellular stress responses. Emerging evidence suggests that HBLD1 plays a pivotal role in regulating cellular processes such as apoptosis, inflammation, and cell proliferation, particularly under low oxygen conditions. Its involvement in these pathways makes it a potential target for therapeutic interventions in diseases where hypoxia is a contributing factor, such as cancer, ischemic heart disease, and neurodegenerative disorders. The recombinant expression of HBLD1 in various model systems allows researchers to dissect its functional roles and interactions with other molecular players within the hypoxia signaling network. Understanding the biochemistry of HBLD1 through recombinant protein studies could unveil novel insights into cellular adaptation mechanisms and provide a framework for developing treatments aimed at ameliorating hypoxia-related pathologies. As such, the study of HBLD1 and its recombinant forms is crucial for both fundamental research and potential clinical applications, prompting a growing interest in the scientific community to explore the therapeutic viability of this protein in the context of hypoxic stress.
