Analytical Data
-
Gene name
SMIM4
- Application
-
Alternative Names
SMIM4；C3orf78；SMIM4；Ubiquinol-cytochrome c reductase complex assembly factor 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVI0
-
Expression Region
1-70aa
-
AA Sequence
MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE
-
Molecular Weight
11.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMIM4 (Small Integral Membrane Protein 4) is a protein that has garnered interest due to its potential role in various biological processes, including cell signaling and membrane organization. Recent studies suggest that SMIM4 may be involved in the regulation of ion channels and transporters, which are critical for maintaining cellular homeostasis and signaling pathways. The importance of membrane proteins in health and disease has prompted researchers to investigate SMIM4's structure and function, particularly in the context of its reconstitution as a recombinant protein. Researchers utilize techniques such as molecular cloning and expression systems to produce SMIM4 in significant quantities, which allows for detailed biochemical and biophysical characterization. Understanding the functional mechanisms of SMIM4 could potentially reveal insights into its role in pathological conditions, including cardiovascular diseases and cancer. Additionally, the study of SMIM4 may provide a basis for developing novel therapeutic strategies aiming to modulate its activity in specific diseases. This research is vital not only for advancing our knowledge of SMIM4 but also for the broader understanding of integral membrane proteins in cellular biology. Overall, the investigation of SMIM4 and its recombinant protein form represents a promising frontier in membrane protein research, with implications for both basic science and clinical applications.
