Cat: PA1000-1189

Recombinant Human GALK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GALK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GALK1;GALK;Galactokinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51570

  • Expression Region

    1-392aa

  • AA Sequence

    MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQG LVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLE PGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATY TFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALL IDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARAL GKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDY RAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGG CTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GALK1 (Galactokinase 1) is an enzyme that plays a crucial role in the galactose metabolism pathway by catalyzing the conversion of galactose to galactose-1-phosphate, a vital process for energy production and proper cellular function. Mutations in the GALK1 gene can lead to classic galactosemia, a genetic disorder characterized by the accumulation of galactose in the body, resulting in severe health issues including liver damage, cataracts, and cognitive impairment. As a result, studying GALK1 and its recombinant protein is essential for understanding the biochemical mechanisms underlying these disorders. Furthermore, recombinant GALK1 protein can serve as a valuable model for designing therapeutic strategies, including enzyme replacement therapy and gene therapy, aimed at ameliorating the symptoms of galactosemia. The production and characterization of GALK1 recombinant protein can also facilitate the development of high-throughput screening methods for potential inhibitors that can mitigate the effects of the disease. Additionally, understanding the structure and function of the GALK1 protein at a molecular level can provide insights into enzyme regulation and substrate specificity, which are critical for advancements in metabolic engineering and the development of biosensors. Overall, research on GALK1 recombinant protein not only enhances our understanding of galactose metabolism but also paves the way for innovative therapeutic approaches to treat genetic disorders associated with this pathway.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US