Analytical Data
-
Gene name
SRD5a1
- Application
-
Alternative Names
SRD5a1；3-oxo-5-alpha-steroid 4-dehydrogenase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18405
-
Expression Region
1-259aa
-
AA Sequence
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRV PARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCL IYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPR FLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF GEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKF RKIIIPFLF
-
Molecular Weight
55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRD5A1 (Steroid 5-alpha-reductase type 1) is an important enzyme that catalyzes the conversion of testosterone into dihydrotestosterone (DHT), a potent androgen involved in the development of male characteristics and various physiological processes. Understanding SRD5A1 is crucial for studying disorders associated with androgen imbalance, such as androgenetic alopecia, prostate hyperplasia, and certain types of cancer. In recent years, research has focused on the recombinant production of SRD5A1 protein to elucidate its molecular mechanisms and regulatory pathways. The ability to produce recombinant SRD5A1 in a controlled environment allows for the exploration of its enzymatic activity, interaction with other proteins, and the impact of genetic variations on its function. Furthermore, these studies can facilitate the development of targeted therapies for conditions linked to altered androgen metabolism. Previous studies have indicated that SRD5A1 may also play a role in diverse biological functions beyond androgen metabolism, including influence on metabolic syndrome and cardiovascular health. Consequently, generating large quantities of high-purity SRD5A1 through recombinant technology not only aids in basic research but also holds potential for therapeutic applications, making it a significant target in endocrinology and pharmacology.
