Analytical Data
-
Gene name
H2AFY2
- Application
-
Alternative Names
Core histone macro H2A2.2; Core histone macro-H2A.2; Core histone macroH2A2.2; H2A histone family member Y2; H2AFY2; H2AW_HUMAN; Histone macroH2A2; Macro H2A.2; Macro H2A2; MacroH2A.2; MacroH2A2; mH2A2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P0M6
-
Expression Region
1-372aa
-
AA Sequence
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
-
Molecular Weight
66.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2AFY2, also known as H2A.z or histone variant H2A.F/Z, is a core component of the histone family that plays a crucial role in the regulation of gene expression and chromatin dynamics. Its unique properties set it apart from canonical histone H2A, enabling it to form distinct nucleosomal structures that influence transcriptional activation and repression. Research on H2AFY2 has garnered significant attention due to its involvement in various cellular processes, including DNA repair, replication, and epigenetic modifications. Notably, H2AFY2 is implicated in several biological pathways linked to developmental processes and diseases, including cancer. As a result, understanding the biochemical properties and functional mechanisms of H2AFY2 is essential for deciphering its role in cellular homeostasis and the pathology of diseases. Recent advancements in recombinant protein technology have facilitated the production and characterization of H2AFY2, allowing researchers to investigate its structural features and interactions with other nuclear proteins. This approach has yielded insights into the importance of H2AFY2 in chromatin remodeling and its potential as a therapeutic target. Overall, the study of H2AFY2 recombinant protein contributes to our understanding of histone variants and their complex roles in gene regulation and cellular physiology.
