Analytical Data
-
Gene name
GABARAPL2
- Application
-
Alternative Names
GABARAPL2；FAM134B；JK1;Reticulophagy regulator 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60520
-
Expression Region
1-117aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVP VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFV DKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GABARAPL2, a protein belonging to the GABA receptor-associated protein family, is primarily involved in the regulation of neurotransmitter signaling and synaptic function. Its significance has been increasingly recognized in neurobiology, particularly concerning its role in autophagy and endosomal trafficking. The study of GABARAPL2 is crucial for understanding the underlying mechanisms of various neurological disorders, including epilepsy, schizophrenia, and neurodegenerative diseases. Recent research has indicated that GABARAPL2 may influence neuronal survival and synaptic plasticity by modulating the degradation and recycling of synaptic proteins. Additionally, its interactions with other proteins involved in these processes make it a potential target for therapeutic interventions. The recombinant production of GABARAPL2 allows for detailed biochemical and biophysical studies, enabling researchers to explore its structure-function relationship and its involvement in cellular pathways. Paralleled with advancements in cryo-electron microscopy and other imaging techniques, investigating GABARAPL2 at a molecular level holds promise for elucidating its role in health and disease, potentially leading to the development of novel strategies for treating neurological conditions.
