Analytical Data
-
Gene name
H2AFB3
- Application
-
Alternative Names
H2A Barr body deficient; H2A Barr body-deficient; H2A histone family member B; H2A.Bbd; H2AB2_HUMAN; H2ABBD; H2AFB; H2AFB1; H2AFB2; H2AFB3; Histone H2A BBD; Histone H2A-Bbd type 1; Histone H2A-Bbd type 2/3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C5Z0
-
Expression Region
1-115aa
-
AA Sequence
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
-
Molecular Weight
12.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2AFB3, a member of the histone H2A family, plays a crucial role in chromatin structure and function, influencing gene expression, DNA repair, and replication processes. The study of H2AFB3 is significant due to its involvement in epigenetic regulation and potential implications in various diseases, including cancer. Recent research has highlighted its role in facilitating the structural transitions of the chromatin necessary for transcriptional activation and silencing, suggesting that the manipulation of H2AFB3 could have therapeutic potential. Additionally, H2AFB3 is linked to cellular responses to stress and differentiation processes, making it a key target for understanding developmental biology and pathogenesis. The recombinant protein form of H2AFB3 enables detailed biochemical and biophysical studies, allowing researchers to dissect its interactions with DNA and other nucleosomal components. This knowledge can provide insights into the mechanisms of chromatin remodeling and the functional consequences of histone modifications. As such, H2AFB3 is a focal point in epigenetics research, with the potential to unveil novel regulatory pathways and therapeutic targets in the context of human diseases. Understanding the dynamics of H2AFB3 and its recombinant protein form can thus advance our comprehension of epigenetic landscapes and their behavioral implications in cellular biology.
