Cat: PA2000-4010

Recombinant Human cspA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    cspA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    cspA;cspS;Cold shock Protein CspA

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A9X9

  • Expression Region

    1-70aa

  • AA Sequence

    MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL

  • Molecular Weight

    7.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CspA, a cold shock protein found in *Escherichia coli*, plays a crucial role in bacterial adaptation to low-temperature environments by promoting mRNA stability and translation. Its ability to regulate gene expression in response to temperature fluctuations makes it a key target for research in bacterial physiology and stress responses. Given its significant role in cold shock responses, CspA has attracted attention for applications in biotechnology and synthetic biology, where enhancing microbial survival and productivity under varying temperature conditions is paramount. The recombinant production of CspA allows for detailed biochemical characterization and functional studies, enabling researchers to elucidate its mechanisms of action, interactions with nucleic acids, and potential applications in industrial processes. Moreover, understanding CspA's structure-function relationships can provide insights into the evolutionary adaptations of bacteria in extreme environments. As microbial applications in biotechnology increase, the importance of proteins like CspA in enhancing stress resilience is becoming clearer, highlighting the necessity for further studies on its recombinant forms and functional properties. This research not only contributes to fundamental microbiological knowledge but also paves the way for innovative strategies in bioprocess optimization and development of cold-active biocatalysts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US