Analytical Data
-
Gene name
GABARAPL1
- Application
-
Alternative Names
GABARAPL1;ZSIG11;Testis-expressed Protein 264
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0R8
-
Expression Region
1-117aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVP VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV NNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GABARAPL1, a member of the GABA(A) receptor-associated protein family, plays a crucial role in various cellular processes, including autophagy, neuronal signaling, and synaptic function. This protein is primarily localized in the endoplasmic reticulum and the Golgi apparatus, where it contributes to the trafficking and stability of GABA(A) receptors, essential for neurotransmission and the modulation of inhibitory synapses in the brain. Recent studies have linked GABARAPL1 to neurodegenerative diseases, such as Alzheimer's and Parkinson's, highlighting its potential role in the pathophysiology of these conditions through its involvement in autophagic pathways that clear damaged proteins and organelles. Moreover, GABARAPL1 has been shown to interact with microtubules, further emphasizing its importance in maintaining cellular integrity and function. Researchers are increasingly interested in recombinant GABARAPL1 protein to explore its structure-function relationships and regulatory mechanisms. By producing and studying this recombinant protein, scientists aim to uncover its molecular interactions, involvement in cellular stress responses, and its impact on neuronal health. Understanding the multifaceted roles of GABARAPL1 may pave the way for novel therapeutic strategies targeting synaptic dysfunction and neurodegeneration, making it a significant focus in the field of neurobiology and cancer research.











