Analytical Data
-
Gene name
H2AFB2
- Application
-
Alternative Names
H2A Barr body deficient; H2A Barr body-deficient; H2A histone family member B; H2A.Bbd; H2AB2_HUMAN; H2ABBD; H2AFB; H2AFB1; H2AFB2; H2AFB3; Histone H2A BBD; Histone H2A-Bbd type 1; Histone H2A-Bbd type 2/3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C5Z0
-
Expression Region
1-115aa
-
AA Sequence
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
-
Molecular Weight
12.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2AFB2, a member of the histone variant family, plays a crucial role in chromatin dynamics and gene regulation. Unlike conventional histones, H2AFB2 is implicated in specific cellular processes such as DNA repair, transcription regulation, and the formation of heterochromatin. Recent research has highlighted its importance in various biological contexts, including embryonic development and responses to environmental stresses. The study of recombinant H2AFB2 proteins is essential for understanding their structural properties and functional mechanisms, as traditional methods of isolation from native sources are often inefficient. By expressing recombinant H2AFB2 in suitable host systems, researchers can obtain large quantities of pure protein for biochemical assays and structural analyses. This approach allows for the exploration of post-translational modifications and interactions with other chromatin-associated proteins, paving the way for insights into its role in epigenetic regulation and potential implications in diseases such as cancer. Additionally, understanding H2AFB2's functions could lead to novel therapeutic strategies targeting chromatin remodeling processes. Overall, the investigation of recombinant H2AFB2 not only contributes to the fundamental knowledge of histone biology but also has significant implications for understanding complex genetic and epigenetic phenomena.
