Cat: PA2000-4009

Recombinant E.coli ihfB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ihfB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ihfB;himD;hip;Integration host factor subunit beta

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A6Y1

  • Expression Region

    1-94aa

  • AA Sequence

    MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

  • Molecular Weight

    10.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IhfB, a subunit of the integration host factor (IHF), plays a crucial role in the regulation of gene expression and DNA bending in prokaryotic organisms. As a histone-like protein, IhfB interacts with DNA to facilitate the formation of higher-order structures, influencing processes such as transcription, replication, and recombination. The study of IhfB has gained significant attention due to its essential functions in bacterial physiology and pathogenesis, making it a potential target for novel antimicrobial strategies. Researchers have been investigating the structural characteristics and functional mechanisms of IhfB to understand its interactions with DNA and other cellular components. Additionally, the recombinant expression of IhfB provides an opportunity to explore its properties in a controlled environment, enabling detailed studies on its role in DNA architecture alteration and gene regulatory networks. This research not only enhances our understanding of fundamental biological processes in bacteria but also opens avenues for biotechnological applications, such as synthetic biology and the development of therapeutic agents against pathogenic bacteria. Overall, the study of IhfB recombinant proteins is pivotal for unraveling the complexities of DNA-protein interactions and their implications in microbial ecology and evolution.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US