Analytical Data
-
Gene name
MTPN
- Application
-
Alternative Names
MTPN;Myotrophin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58546
-
Expression Region
1-118aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMCDKEFMWALKNGDLDEVKDYVAKGEDVNR TLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGH VSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTPN (myotrophin) is a protein that has gained significant attention in the field of molecular biology and biochemistry due to its potential role in muscle development and cardioprotection. Initially identified as a regulator of cardiac hypertrophy, MTPN is believed to influence various cellular processes, including apoptosis, cell proliferation, and differentiation. Research has indicated that MTPN might play a critical role in muscle regeneration and repair, particularly in response to stressors like injury or disease. Studies have shown that altered expression of MTPN is associated with various cardiac and neuromuscular disorders, suggesting that it could be a key component in understanding disease mechanisms. Furthermore, recombinant MTPN proteins have been expressed for use in experimental analyses, enabling researchers to investigate its functional properties in vitro and in vivo. This emphasis on recombinant MTPN facilitates the exploration of its biochemical pathways, interactions with other proteins, and its potential as a therapeutic target. Consequently, ongoing research aims to elucidate its precise role in muscle and cardiac physiology, which may pave the way for novel treatment strategies for related muscular and cardiac conditions.











