Cat: PA1000-9775

Recombinant Human MTPN Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MTPN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MTPN;Myotrophin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P58546

  • Expression Region

    1-118aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMCDKEFMWALKNGDLDEVKDYVAKGEDVNR TLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGH VSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MTPN (myotrophin) is a protein that has gained significant attention in the field of molecular biology and biochemistry due to its potential role in muscle development and cardioprotection. Initially identified as a regulator of cardiac hypertrophy, MTPN is believed to influence various cellular processes, including apoptosis, cell proliferation, and differentiation. Research has indicated that MTPN might play a critical role in muscle regeneration and repair, particularly in response to stressors like injury or disease. Studies have shown that altered expression of MTPN is associated with various cardiac and neuromuscular disorders, suggesting that it could be a key component in understanding disease mechanisms. Furthermore, recombinant MTPN proteins have been expressed for use in experimental analyses, enabling researchers to investigate its functional properties in vitro and in vivo. This emphasis on recombinant MTPN facilitates the exploration of its biochemical pathways, interactions with other proteins, and its potential as a therapeutic target. Consequently, ongoing research aims to elucidate its precise role in muscle and cardiac physiology, which may pave the way for novel treatment strategies for related muscular and cardiac conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US