Analytical Data
-
Gene name
bcd
- Application
-
Alternative Names
bcd；B-cell differentiation antigen CD72
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09081
-
Expression Region
1-494aa
-
AA Sequence
MAQPPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAIAVGETEAADDMDDGTSKKTTLQILEPLKGLDKSCDDGSSDDMSTGIRALAGTGNRGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYNPHRNAAGNSQFAYCFN
-
Molecular Weight
54.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BCD recombinant proteins, derived from the bacterial collagenase domain, have garnered significant attention in biomedical research and therapeutic applications due to their structural and functional versatility. The BCD domain is integral in facilitating protein interactions and enhancing stability, making it a valuable component in the engineering of therapeutic proteins and vaccines. Researchers have focused on BCD's role in modulating immune responses, especially in the context of designing more effective adjuvants for vaccines, which aim to improve the body’s immune reaction to antigens. The interest in recombinant proteins is further driven by advances in genetic engineering techniques, allowing for the precise manipulation of protein structures, enhancing their efficacy and safety profiles. Moreover, the use of BCD recombinant proteins extends to the fields of tissue engineering and regenerative medicine, where they can aid in the development of biomaterials that mimic natural tissue characteristics. This multifaceted application spectrum underscores the importance of ongoing research into BCD recombinant proteins, as it holds the potential to revolutionize treatment modalities for various diseases and improve overall health outcomes. Understanding the mechanisms underlying BCD protein function and interaction with other biomolecules will pave the way for innovative therapeutic strategies, aligning with the broader goal of personalized medicine.
