Cat: PA1000-1150

Recombinant Human FSBP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FSBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FSBP;Fibrinogen silencer-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95073

  • Expression Region

    1-299aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMVGKARSSNFTLSEKLDLLKLVKPYVK ILEEHTNKHSVIVEKNRCWDIIAVNYNAIGVDRPPRTAQGLRTLYKRLKE YAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQSAN LDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLE QREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRS LLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRA KIEVEKLKAIRLRHDLPEYNSL

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FSBP (Fibroblast Growth Factor 2 Binding Protein) is a protein that plays a crucial role in a variety of cellular processes, including cell proliferation, differentiation, and angiogenesis. Its involvement in numerous physiological and pathological conditions, such as wound healing, cancer, and tissue regeneration, has spurred considerable interest in understanding its structure and function. Recent advances in recombinant DNA technology have enabled the production of FSBP in higher quantities and with increased purity, facilitating in-depth studies of its properties. Researchers aim to elucidate the molecular mechanisms underlying FSBP interactions with fibroblast growth factors (FGFs) and to explore its potential as a therapeutic target. Furthermore, characterizing the recombinant FSBP allows for the development of novel biomaterials and regenerative medicine applications. The ability to manipulate and study FSBP in laboratory settings has accelerated research efforts aimed at discovering new interventions for diseases involving impaired regeneration or abnormal FGF signaling. Understanding the functional dynamics of FSBP can ultimately lead to improved strategies for tissue engineering and the treatment of various diseases, marking it as a significant focus within the realm of biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US