Analytical Data
-
Gene name
GRIK4
- Application
-
Alternative Names
EAA 1; EAA1; Excitatory amino acid receptor 1; GluK4; Glutamate receptor; Glutamate receptor ionotropic kainate 4; Glutamate receptor ionotropic kainate 4 precursor; Glutamate receptor KA 1; Glutamate receptor KA 1precursor; Glutamate receptor KA-1; Glutamate receptor KA1; Glutamate receptor; ionotropic kainate 4; GRIK 4; GRIK; Grik4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16099
-
Expression Region
21-130aa
-
AA Sequence
SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQ
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRIK4, or Glutamate Receptor Ionotropic, Kainate 4, is a member of the ionotropic glutamate receptor family, which plays a crucial role in excitatory neurotransmission in the central nervous system. Research into GRIK4 has gained traction due to its significant involvement in various neurophysiological processes, including learning, memory, and synaptic plasticity. Aberrant functioning or dysregulation of GRIK4 has been implicated in several neurological and psychiatric disorders, such as schizophrenia, epilepsy, and anxiety disorders. The functional properties of GRIK4, including its ion channel activity and interactions with other cellular proteins, make it a potential target for therapeutic interventions. Recombinant GRIK4 protein production allows researchers to study its structure, function, and pharmacological properties in detail, facilitating the understanding of its role in health and disease. By generating and characterizing this protein, scientists aim to elucidate the mechanisms underlying GRIK4-related pathologies and to explore its potential as a drug target in neurotherapeutics. This research is essential for developing novel therapeutic approaches that could ameliorate conditions associated with GRIK4 dysfunction.
