Analytical Data
-
Gene name
FCER1A
- Application
-
Alternative Names
FCER1A;FCE1AFBX6;High affinity immunoglobulin epsilon receptor subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12319
-
Expression Region
1-257aa
-
AA Sequence
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLT CNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNE SEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHP KPNPKNN
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FCER1A, also known as the high-affinity IgE receptor alpha chain, plays a crucial role in the immune system, particularly in allergic responses. It is a primary component of the Fc epsilon receptor complex, which mediates the binding of immunoglobulin E (IgE) to immune cells like mast cells and basophils. When allergens cross-link IgE bound to FCER1A, it triggers degranulation and the release of inflammatory mediators, leading to allergic symptoms. Research on FCER1A recombinant protein focuses on understanding its structure-function relationship, signal transduction mechanisms, and its role in various allergic diseases, including asthma, rhinitis, and anaphylaxis. By studying the recombinant form of FCER1A, scientists aim to elucidate the molecular interactions and pathways involved in IgE-mediated activation, which can pave the way for the development of targeted therapies for allergic conditions. Furthermore, the production of FCER1A recombinant protein allows for the creation of specific antibodies and diagnostic tools, enhancing our ability to investigate and diagnose allergic disorders effectively. Overall, this research is essential for advancing our knowledge of allergy mechanisms and improving therapeutic strategies for affected individuals.











