Analytical Data
-
Gene name
MGAT4A
- Application
-
Alternative Names
MGAT4A;Alpha-1.3-mannosyl-glycoProtein 4-beta-N-acetylglucosaminyltransferase A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UM21
-
Expression Region
93-535aa
-
AA Sequence
LLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGAT4A, or Mannosyl-Glycoprotein Acetylglucosaminyltransferase 4A, is a critical enzyme involved in N-glycan processing within the endoplasmic reticulum and Golgi apparatus. It plays a fundamental role in the synthesis of complex glycoproteins by catalyzing the addition of N-acetylglucosamine (GlcNAc) to high-mannose and hybrid-type N-glycans. This modification is crucial for proper protein folding, stability, and function, affecting various cellular processes, including cell signaling and immune response. Dysregulation of MGAT4A expression has been associated with various diseases, including cancer, where altered glycosylation patterns contribute to tumor progression and metastasis. Research into recombinant MGAT4A protein has gained attention as it may offer insights into the enzyme's structure-function relationships and its potential as a therapeutic target. Additionally, the study of MGAT4A and its recombinant forms aids in the development of glycoengineering strategies for biopharmaceutical production, enhancing the efficiency and efficacy of glycoprotein therapeutics. Understanding MGAT4A’s enzymatic mechanisms will not only advance the fields of glycobiology and biochemistry but also facilitate the design of novel interventions for diseases linked to glycosylation abnormalities. As such, MGAT4A stands at the intersection of fundamental biological research and applied biomedical science, highlighting its significance in advancing both basic research and therapeutic development.











