Analytical Data
-
Gene name
GPR55
- Application
-
Alternative Names
G-protein coupled receptor 55
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2T6
-
Expression Region
1-319aa
-
AA Sequence
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR AHRPSRVQLVLQDTTISRG
-
Molecular Weight
36.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR55, a member of the G protein-coupled receptor (GPCR) family, has garnered increasing interest in recent years due to its potential role in various physiological and pathological processes. Initially identified as a cannabinoid receptor, GPR55 is activated by a range of ligands, including certain cannabinoids, lysophosphatidylinositol, and other lipid metabolites. Research indicates that GPR55 plays significant roles in the modulation of pain perception, inflammation, and neuroprotection, making it a promising target for therapeutic interventions. Additionally, its involvement in cancer biology, specifically in regulating tumor growth and metastasis, has spurred investigations into its functions and signaling mechanisms. The reconstitution of GPR55 as a fusion protein has enabled detailed studies of its structure, ligand-binding properties, and downstream signaling pathways. Understanding GPR55's diverse functions could facilitate the development of novel pharmacological strategies for various diseases, including neurodegenerative disorders and cancer. Thus, the exploration of GPR55 recombinant proteins has become a critical area of research, aiming to unlock the full potential of this receptor in health and disease.











