Analytical Data
-
Gene name
HSD3B1
- Application
-
Alternative Names
HSD3B1;3BH;HSDB3A;3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14060
-
Expression Region
2-237aa
-
AA Sequence
TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILAL
-
Molecular Weight
33.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of HSD3B1 (3β-hydroxysteroid dehydrogenase type 1) recombinant protein has gained significant attention due to its critical role in steroidogenesis, particularly in the biosynthesis of adrenal steroids and sex hormones. This enzyme catalyzes the conversion of pregnenolone to progesterone and dehydroepiandrosterone (DHEA) to androstenedione, which are essential precursors in the synthesis of various steroid hormones. Dysregulation of HSD3B1 activity has been implicated in several diseases, including adrenal insufficiency, polycystic ovary syndrome (PCOS), and certain cancers, making it a valuable target for therapeutic intervention. The development of HSD3B1 recombinant protein allows for in-depth pharmacological studies, enabling researchers to better understand its enzymatic mechanisms, substrate specificity, and interactions with potential inhibitors or activators. This could lead to the identification of new biomarkers for disease states and the development of novel treatment strategies. Additionally, recombinant HSD3B1 can facilitate high-throughput screening for drug discovery, providing insights into the modulation of steroid pathways, which could have broad implications for hormonal health and endocrine disorders. Understanding HSD3B1’s role not only contributes to basic science but also opens potential avenues for clinical applications in managing conditions associated with steroid imbalances. Thus, the research surrounding HSD3B1 recombinant protein is pivotal in advancing both our scientific knowledge and therapeutic capabilities in the field of endocrinology.











