Analytical Data
-
Gene name
NSMCE3
- Application
-
Alternative Names
NSMCE3；Non-structural maintenance of chromosomes element 1 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MG7
-
Expression Region
1-304aa
-
AA Sequence
MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS
-
Molecular Weight
38.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NSMCE3 is a key protein that plays a critical role in various cellular processes, including DNA repair, cell cycle regulation, and protein homeostasis. Its significance is underscored by its involvement in the maintenance of genome integrity and susceptibility to various diseases, including cancer. Mutations and dysregulation of NSMCE3 have been linked to various pathological conditions, making it a target of interest for therapeutic interventions. Research has shown that NSMCE3 is part of the MAGE-RING E3 ligase complex, which is essential for ubiquitination processes that tag proteins for degradation or functional modulation. This function is vital for cellular responses to stress and DNA damage, and proper NSMCE3 activity is crucial for preventing cellular transformations that could lead to tumorigenesis. The study of NSMCE3 and its recombinant forms is essential for elucidating its mechanisms of action and potential roles in cancer therapy. Furthermore, understanding the structure-function relationship of NSMCE3 through recombinant protein studies can provide insights into how it interacts with other cellular components. This knowledge could pave the way for developing novel treatment strategies that target NSMCE3-related pathways, thereby contributing to the advancement of precision medicine in oncology and beyond.
