Analytical Data
-
Gene name
BAGE2
- Application
-
Alternative Names
BAGE2；B melanoma antigen 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86Y30
-
Expression Region
18-109aa
-
AA Sequence
RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS
-
Molecular Weight
17.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BAGE2, a member of the BAGE gene family, is known for its potential role in tumor biology and immune response. The BAGE genes, characterized by their expression in various cancers yet minimal presence in normal tissues, are considered promising targets for cancer immunotherapy. BAGE2, specifically, has garnered attention due to its tumor-associated expression pattern, suggesting it may serve as a tumor-specific antigen. Research has indicated that BAGE2 can stimulate immune responses, making it a candidate for therapeutic vaccines aimed at enhancing anti-tumor immunity. Additionally, the study of BAGE2 provides insights into the mechanisms of cancer progression and immune evasion. As researchers continue to investigate the properties and functions of BAGE2, including its potential interactions with immune cells, there is growing interest in understanding its role in creating robust, targeted cancer treatments. This focus aligns with broader trends in personalized medicine, where identifying unique tumor markers is crucial for developing effective, individualized therapies. The ongoing exploration of BAGE2 and associated recombinant proteins aims not only to elucidate their biological functions but also to leverage their immunogenic properties in the fight against cancer.
