Analytical Data
-
Gene name
DUX4
- Application
-
Alternative Names
DUX4；DUX10；Double homeobox Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBX2
-
Expression Region
327-424aa
-
AA Sequence
AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
-
Molecular Weight
14.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUX4 is a double homeobox gene that has garnered significant attention in the field of molecular biology and genetics due to its role in facioscapulohumeral muscular dystrophy (FSHD), a genetic disorder characterized by progressive muscle weakness and atrophy. The DUX4 protein is normally silenced in most tissues but can be aberrantly expressed in skeletal muscle cells in individuals with FSHD, leading to muscle degeneration. Research has highlighted that the pathogenic mechanism of DUX4 involves the activation of a series of downstream genes that induce apoptosis and disrupt myogenic differentiation. Understanding the molecular pathways influenced by DUX4 expression is crucial in elucidating the complexities of FSHD pathology. Recent studies have focused on the functional characterization of DUX4 as a recombinant protein, allowing researchers to explore its biochemical properties, interactions with other proteins, and its effects on muscle cell biology. By utilizing techniques such as gene editing, proteomics, and cell culture models, scientists aim to uncover the precise mechanisms by which DUX4 contributes to muscle degeneration. This knowledge not only enhances our understanding of FSHD but also paves the way for potential therapeutic strategies aimed at targeting the DUX4 signaling pathway to mitigate the effects of the disease. As research continues to evolve, the DUX4 recombinant protein remains a focal point for investigating the interplay between gene regulation, muscle health, and the development of muscular dystrophies.
