Cat: PA1000-9688

Recombinant Human ACVR1C Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACVR1C

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACVR1C;ALK7;Activin receptor type-1C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NER5

  • Expression Region

    1-493aa

  • AA Sequence

    MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASV MLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLP TASPNAPKLGPMELAIIITVPVCLLSIAAMLTVWACQGRQCSYRKKKRPN VEEPLSECNLVNAGKTLKDLIYDVTASGSGSGLPLLVQRTIARTIVLQEI VGKGRFGEVWHGRWCGEDVAVKIFSSRDERYWFREAEIYQTVMLRHENIL GFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTMAGMIKLALSIA SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDS ILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWE IARRCSVGGIVEEYQLPYYDMVPSDPSIEEMRKVVCDQKFRPSIPNQWQS CEALRVMGRIMRECWYANGAARLTALRIKKTISQLCVKEDCKA

  • Molecular Weight

    80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACVR1C, also known as Activin A receptor type 1C, is a member of the transforming growth factor-beta (TGF-β) receptor superfamily. It plays a crucial role in various biological processes, including embryonic development, tissue homeostasis, and the regulation of inflammatory responses. The protein is known to be involved in signaling pathways that contribute to the differentiation and proliferation of cells, particularly in the context of mesodermal and ectodermal lineages. Dysregulation of ACVR1C expression or function has been implicated in several pathological conditions, including fibrotic diseases, cancer, and metabolic disorders. Research into recombinant ACVR1C protein has gained traction as scientists aim to better understand its structure, function, and potential therapeutic applications. By producing recombinant forms of ACVR1C, researchers can investigate its interactions with other signaling molecules and its role in cellular responses to stimuli. This research could pave the way for novel therapeutic strategies targeting ACVR1C-related pathways, offering new hope for the treatment of diseases characterized by aberrant TGF-β signaling. Furthermore, understanding the mechanistic details of ACVR1C function may provide insights into the development of biomolecular tools and diagnostics, potentially leading to improved patient outcomes in conditions associated with its dysregulation. As a result, studies involving the purification and characterization of recombinant ACVR1C are critical for advancing our knowledge of this important receptor and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US