Analytical Data
-
Gene name
GPR172B
- Application
-
Alternative Names
FLJ10060; G protein coupled receptor 172B; GPCR; GPCR42; hRFT1; member 1; OTTHUMP00000125300; PAR2; PERV-A receptor 2; PERVA receptor 2; Porcine endogenous retrovirus A receptor 2; Protein GPR172B; Putative G protein coupled receptor GPCR42; Riboflavin transporter 1; riboflavin transporter; S52A1_HUMAN; SLC52A1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NWF4
-
Expression Region
1-448aa
-
AA Sequence
MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
-
Molecular Weight
72.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR172B, a member of the G protein-coupled receptor (GPCR) family, has garnered interest due to its potential roles in various physiological processes and implications in disease mechanisms. Initially discovered through genomic studies, GPR172B's expression is observed in several tissues, including the brain and immune system, suggesting its involvement in neuronal signaling and immune responses. Recent research indicates that GPR172B may play a role in metabolic regulation and cell differentiation, which has piqued the curiosity of scientists looking to understand its functional pathways. The characterization of GPR172B as a recombinant protein is crucial for elucidating its biological functions and therapeutic potential. By producing and purifying GPR172B in a recombinant form, researchers aim to conduct binding assays, signaling studies, and structural analyses to uncover its mechanisms of action. Given the significant role of GPCRs in drug discovery, GPR172B holds promise as a novel target for therapeutic intervention, especially in metabolic disorders and neurological conditions. Understanding GPR172B's structure and function could lead to innovative strategies to modulate its activity and develop new treatments. Therefore, the study of GPR172B recombinant protein is vital for advancing our knowledge of GPCR biology and exploring its potential clinical applications.
