Analytical Data
-
Gene name
GPR162
- Application
-
Alternative Names
GPR162; GRCA; Probable G-protein coupled receptor 162; Gene-rich cluster gene A protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16538
-
Expression Region
1-304aa
-
AA Sequence
MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL
-
Molecular Weight
59.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR162 is a member of the G protein-coupled receptor (GPCR) family, which plays a crucial role in various physiological processes and signaling pathways. Initial investigations have indicated that GPR162 is predominantly expressed in the brain and may be involved in the regulation of neurophysiological functions. Given the significant role of GPCRs in drug discovery and their implications in numerous diseases, including neurological disorders, the need for a deeper understanding of GPR162's structure and function has emerged. Recent studies have focused on the recombinant expression of GPR162 protein to facilitate the analysis of its functional properties, ligand interactions, and downstream signaling mechanisms. By producing a stable recombinant form of GPR162, researchers aim to elucidate its role in cellular signaling and its potential as a therapeutic target. This research not only contributes valuable data to the GPCR field but also enhances the understanding of the molecular basis of GPR162's functions, paving the way for future drug development efforts aimed at modulating its activity in various pathophysiological contexts. The recombinant protein provides a foundational tool for functional assays, structure-based drug design, and the exploration of GPR162's involvement in neuropsychological conditions, potentially leading to novel therapeutic approaches.
