Analytical Data
-
Gene name
HOXA2
- Application
-
Alternative Names
HOXA2；HOX1K；Homeobox Protein Hox-A2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43364
-
Expression Region
26-124aa
-
AA Sequence
PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGP
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HOXA2 is a member of the homeobox gene family, which plays a crucial role in embryonic development and the regulation of gene expression during various stages of cellular differentiation. The research on HOXA2 recombinant proteins has gained momentum due to the gene's significant involvement in craniofacial morphogenesis, particularly its association with hypoplasia and various congenital disorders affecting the head and neck region. Mutations or dysregulation of HOXA2 expression can lead to developmental abnormalities such as microtia and other ear malformations. Given its pivotal role in developmental biology, studying HOXA2 recombinant proteins enables scientists to elucidate the specific molecular mechanisms underlying these conditions. Furthermore, the production of HOXA2 recombinant proteins allows for functional assays and the evaluation of potential therapeutic interventions in gene therapy and regenerative medicine. By exploring the structure and function of HOXA2, researchers aim to uncover insights into its interactions with other proteins and regulatory factors, thereby contributing to a deeper understanding of developmental processes and potential strategies for mitigating associated disorders.
