Analytical Data
-
Gene name
VACWR156
- Application
-
Alternative Names
VACWR156；Protein OPG161
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68617
-
Expression Region
57-185aa
-
AA Sequence
VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
-
Molecular Weight
16.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR156 is a recombinant protein derived from the Vaccinia virus, a member of the Poxviridae family known for its use in vaccination and gene therapy applications. Research interest in VACWR156 has surged due to its potential role in modulating immune responses, particularly in the context of viral infections and cancer therapies. Studies indicate that VACWR156 might function as an immune evasion factor, influencing dendritic cell maturation and T-cell activation. Understanding the mechanisms by which VACWR156 interacts with the host immune system could provide insights into enhancing vaccine efficacy and developing novel immunotherapeutics. The protein has also garnered attention for its use as a tool in exploring the pathogenicity of poxviruses and for the development of next-generation vaccines. Investigations into VACWR156 aim to elucidate its structure-function relationships, optimize its delivery systems, and evaluate its safety and effectiveness in clinical settings, thereby contributing to the ongoing efforts to combat viral diseases and improve cancer treatment outcomes.
