Analytical Data
-
Gene name
MT2731
- Application
-
Alternative Names
MT2731；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WJ10
-
Expression Region
1-81aa
-
AA Sequence
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
-
Molecular Weight
9.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT2731 is a recombinant protein that has garnered interest in the field of biotechnology due to its potential applications in various biological and pharmaceutical processes. The protein is derived from a specific microbial source, known for its unique properties that can be harnessed for therapeutic purposes. Research into MT2731 explores its structure, function, and mechanisms of action, particularly regarding its role in enzyme catalysis and cellular processes. Studies suggest that MT2731 may exhibit antioxidant activity, which can protect cells from oxidative stress and inflammation, making it a candidate for developing treatments for diseases associated with such conditions. Furthermore, understanding the gene expression and regulatory mechanisms underlying MT2731 production could contribute significantly to optimizing industrial processes for protein synthesis. As the demand for biopharmaceuticals continues to rise, exploring recombinant proteins like MT2731 provides opportunities for innovation in drug development and regenerative medicine. Scientists are increasingly focusing on the protein's stability, efficacy, and safety through various purification and characterization techniques. The ongoing research not only aims to elucidate MT2731's biochemical pathways but also seeks to harness its properties for therapeutic applications, emphasizing the critical intersection of molecular biology and engineering in advancing modern medicine.
